DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and SYTL4

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001357091.1 Gene:SYTL4 / 94121 HGNCID:15588 Length:676 Species:Homo sapiens


Alignment Length:307 Identity:65/307 - (21%)
Similarity:123/307 - (40%) Gaps:48/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 LELSLLYDAPMRKMTVHVMQAKNLPPLGSG-QTTHTQVRMLMLPSKKQ--KLKTKI-RSGENPQY 354
            :..||.|:...:.:.|||.:...|...... :.::..|:..:||.|.:  |.||.| |...||.|
Human   360 IAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLY 424

  Fly   355 MESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETNLWLPLEPR---NT 416
            .|: |.:.:....:....|:..::...|..:...:|||.:...:..|:.:.:..|||..:   .:
Human   425 DET-LRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAES 488

  Fly   417 SSGLGSTSDLLSLARSESAGSTSSMQHGGVSELLLGLSY----------------NGVTGRLSVE 465
            .:||.|                    |.|  ||::.|.|                .|..|.|.|.
Human   489 PTGLPS--------------------HKG--ELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVW 531

  Fly   466 IIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQ-VALFQLNDV 529
            |.:.....:.......|::||..:: .:..:.|:.||.:.:...||.:..||.:. |.|..|..:
Human   532 IKEAKNLTAAKAGGTSDSFVKGYLL-PMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHM 595

  Fly   530 TLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEM 576
            .|.::|:.:..:..|:.:|...||:.:...:.:.....:|...:|.:
Human   596 CLELTVWDREPLASNDFLGGVRLGVGTVNIQPILIECLLCARTRGRL 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 30/122 (25%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 30/148 (20%)
SYTL4NP_001357091.1 FYVE_2 8..121 CDD:308117
FYVE_Slp4 58..107 CDD:277303
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..243
C2A_SLP-4_5 357..481 CDD:175995 29/121 (24%)
C2B_SLP_1-2-3-4 496..>622 CDD:175987 29/128 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.