DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and SYT8

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_011518757.1 Gene:SYT8 / 90019 HGNCID:19264 Length:539 Species:Homo sapiens


Alignment Length:374 Identity:89/374 - (23%)
Similarity:148/374 - (39%) Gaps:86/374 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 CGEHRAKTQALRYQHRVNVAAPPKLDKERDNVLVVPMVNAYSINNNNNSITTSNNHPSSNNNDDE 260
            |..||.|.:                |||           :..:.:...:.||....|        
Human   212 CRRHRKKPR----------------DKE-----------SVGLGSARGTTTTHLVQP-------- 241

  Fly   261 PLFDTSDLRSIKSDDLLVGVDQKEPAVQRGPIELELSLLYDAPMRKMTVHVMQAKNLPPLGSGQT 325
               |...|.|...|           |.|.|.  |:|||.:|...:::.|.:.||.:|.|   |.|
Human   242 ---DVDGLESSPGD-----------AQQWGC--LQLSLEFDFGSQEIRVGLRQAADLRP---GGT 287

  Fly   326 THTQVRMLMLPSKKQKLKTKIRSGE-NPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLI 389
            .....|:.:......:.:||:..|. .|.:.|:...| :...::....|:|:|:..:|......:
Human   288 VDPYARVSVSTQAGHRHETKVHRGTLCPVFDETCCFH-IPQAELPGATLQVQLFNFKRFSGHEPL 351

  Fly   390 GEAYVSFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSESAGSTSSMQHGGVSELLLGLS 454
            ||..:...||||:.....|..|                        |..::.|...|.||...|.
Human   352 GELRLPLGTVDLQHVLEHWYLL------------------------GPPAATQPEQVGELCFSLR 392

  Fly   455 YNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAF 519
            |...:|||:|.:::.   |.|....| :.|||:.::.: .::..:.||:.::|...|.|.|.|.|
Human   393 YVPSSGRLTVVVLEA---RGLRPGLA-EPYVKVQLMLN-QRKWKKRKTATKKGTAAPYFNEAFTF 452

  Fly   520 QVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADV 568
            .|...|:.:|.|:::|:.:....:.|.||...||..:|| :.:.||||:
Human   453 LVPFSQVQNVDLVLAVWDRSLPLRTEPVGKVHLGARASG-QPLQHWADM 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 31/122 (25%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 39/123 (32%)
SYT8XP_011518757.1 C2 257..370 CDD:301316 30/118 (25%)
C2 385..514 CDD:301316 38/122 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.