DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and SYT16

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001354585.1 Gene:SYT16 / 83851 HGNCID:23142 Length:645 Species:Homo sapiens


Alignment Length:594 Identity:197/594 - (33%)
Similarity:304/594 - (51%) Gaps:76/594 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LFLFISRKCCFHYRHAINCCD--------------ERHLAVKCVQKITRKRRYENTSSDSEE--D 85
            |||.:.     |:    :||:              .:|....|    :...::.|.:||..:  .
Human    84 LFLEVD-----HF----SCCNSDLQDSAQNSSPSLSQHAKDSC----STMSQWPNWASDDRKLPH 135

  Fly    86 ILRRLRWHQQHQLGEKPGGYGLGISQANPLTAQSFN-YHQAGASADLQRVTVSRD-PLAIAERGK 148
            :|..:. .::|.|.::..|...|.....|.|.::.| ..|..:..|.:.::.|.| ...:.::.:
Human   136 VLSSIA-EEEHHLEKQRSGLQHGFDSQLPGTLETVNGKKQVNSFGDDEELSTSSDSDEEVIKQFE 199

  Fly   149 VGIPSSHSECSSNDSMEVSVDSHTGVLTGL------SKATTTVPHPATAFRNPC-----GEHRAK 202
            :.:..|.|        ..||.|..|..|||      |::..|.....|.. :.|     ...|..
Human   200 ISVSRSQS--------FRSVTSEKGKQTGLEQKPKFSRSLLTHGEDGTEV-SACEDLDGASQRRY 255

  Fly   203 TQALRYQHRVNVAAPPKLDKERDNVLVVPMVNAYSINNNNNSITTSNNHPSSNNN---------- 257
            ::.|.|....::.|..:...||.:      ...:..::..:|:..|....|:..:          
Human   256 SENLSYGEDDHIPAHSQSPCERGD------AKHHGTSHQESSVVQSLRRQSTEGSLEMETAFNSR 314

  Fly   258 --DDEPLFDTSDLRSIKSDD---LLVGVDQKEPAVQRGPIELELSLLYDAPMRKMTVHVMQAKNL 317
              :|....|:|.:.|.:..|   |.|.....||..:.|  :|::...|.|..:|:||.:::|:.|
Human   315 GFEDSYATDSSSMWSPEEQDRTNLQVPSGVSEPISKCG--DLDVIFEYRAASQKLTVTIVRAQGL 377

  Fly   318 PPLGSGQTTHTQVRMLMLPSKKQKLKTKIRSGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCER 382
            |..........||.:::||.||.:.:|.|:.|.||.:.|.....::.|.||....:|.|||...:
Human   378 PDKDRSGVNSWQVHVVLLPGKKHRGRTNIQRGPNPVFREKVTFAKLEPRDVAACAVRFRLYAARK 442

  Fly   383 LRKERLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSESAGSTSSMQHGGVS 447
            :.:||::||.....:.:..|.|..:.|.||||:..|..||.....:::.|:|..||.|:.|||..
Human   443 MTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAP 507

  Fly   448 ELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPL 512
            |||:|||||..|||||||:||||.||:|::|:|||||.|:.:::|:|||:||.|||||||||||:
Human   508 ELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPV 572

  Fly   513 FKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEML 577
            :||||.||||||||:|||||||||.:|.||:.||:||.:||.||||.||..||.::.| .||:.:
Human   573 YKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKE-TKGQQI 636

  Fly   578 ARWHVLVDS 586
            .|||.|::|
Human   637 CRWHTLLES 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 36/121 (30%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 90/137 (66%)
SYT16NP_001354585.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..121 2/22 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..192 11/47 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..344 28/152 (18%)
C2A_Synaptotagmin-14_16 350..473 CDD:176035 37/124 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 478..503 8/24 (33%)
C2B_Synaptotagmin-14_16 506..643 CDD:176053 90/137 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3989
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 312 1.000 Inparanoid score I2585
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D339484at33208
OrthoFinder 1 1.000 - - FOG0002721
OrthoInspector 1 1.000 - - otm40377
orthoMCL 1 0.900 - - OOG6_109712
Panther 1 1.100 - - LDO PTHR46129
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5537
SonicParanoid 1 1.000 - - X2510
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.