DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and AT2G21010

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_179697.2 Gene:AT2G21010 / 816635 AraportID:AT2G21010 Length:256 Species:Arabidopsis thaliana


Alignment Length:275 Identity:63/275 - (22%)
Similarity:99/275 - (36%) Gaps:95/275 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 MEVSVDSHTGVLTGLSKATTTVPHP----------ATAFRNPCGEHRAKTQALRYQHRVNVAAPP 218
            :|:|.|.       :|...|||.|.          ..:.|:|      |||.|.:    ||....
plant    10 IELSEDK-------ISSKKTTVKHKNLNPEWNEEFKFSVRDP------KTQVLEF----NVYGWE 57

  Fly   219 KL---DKERDNVLVVPMVNAYSINNNNNSITTSNNHPSSNNNDDEPLFDTSDLRSIKSDDLLVGV 280
            |:   ||...|||.:..:..                      |:...| |.:||.     .|.|.
plant    58 KIGKHDKMGMNVLALKELAP----------------------DERKAF-TLELRK-----TLDGG 94

  Fly   281 DQKEPAVQRGPIELELSLLYDAPMRKMTVHVMQAKNLPPLGSG----------------QTTHTQ 329
            ::.:|...||.:|:|  |||    :..|...|||....|.|:.                :..|..
plant    95 EEGQPGKYRGKLEVE--LLY----KPFTEEEMQAVQKAPEGTPVAGGMLVVIVHSAEDVEGKHHT 153

  Fly   330 VRMLMLPSKKQKLKTK-IRSGENPQYME--SFLL-----HRVNPEDVNNMGLRVRLYGCERLRKE 386
            ...:.:..|.::.||| ::..::|::.|  ||:|     |.....:|.:...|:.|     |..:
plant   154 NPYVHIYFKGEERKTKNVKKNKDPKWNEEFSFMLEEPPVHEKLHVEVFSTSSRIGL-----LHPK 213

  Fly   387 RLIGEAYVSFATVDL 401
            ..:|  ||....||:
plant   214 ETLG--YVDIPVVDV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 31/135 (23%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053
AT2G21010NP_179697.2 C2 2..87 CDD:278593 25/116 (22%)
C2 135..238 CDD:278593 20/99 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.