DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and Syt13

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_109650.1 Gene:Syt13 / 80976 MGIID:1933945 Length:426 Species:Mus musculus


Alignment Length:451 Identity:101/451 - (22%)
Similarity:166/451 - (36%) Gaps:120/451 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 GVLT-----GLSKATTTV-PHPATAFRNPCGEHRAKT--QALRY-----QHRVNVAAPPKLDKER 224
            |||.     .:.|:|..| |.|...|.:..|...|.|  :.:.|     :.....|||.....:.
Mouse    54 GVLQAAQQFNIKKSTEPVQPRPLLKFPDIYGPRPAVTAPEVINYADYTLETTEESAAPASPQAQS 118

  Fly   225 DNVLVVPMVNAYSINNNNNSI------TTSNNHPSSNNND----------DE---PLFDTSDLRS 270
            |:.|...:....||...|..:      .|.|...:::.|.          |:   .||.|| |.:
Mouse   119 DSRLKRQVTEELSIRPQNGVVEDVCVMETWNPEKAASWNQAPKLHFRLDYDQKKAELFVTS-LEA 182

  Fly   271 IKSD-----DLLVGVDQKEPAVQRGPIELELSLLYDAPMRKMTVHVMQAKNLP-PLGSGQTTHTQ 329
            :.||     |..:   |...||:.|.:|.:.:|      :|..:|....:.|. |||.       
Mouse   183 VTSDHEGGCDCYI---QGSVAVKTGSVEAQTAL------KKRQLHTTWEEGLALPLGE------- 231

  Fly   330 VRMLMLPSKKQKLKTKIRSGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYV 394
                                                |::....|.:.|..|:|..:..:|||   
Mouse   232 ------------------------------------EELPTATLTLTLRTCDRFSRHSVIGE--- 257

  Fly   395 SFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSESAGSTSSMQHGGVSELLLGLSYNGVT 459
                        |.|.|:..:...|.....:|.:.|:..|||:         .|:||.:||....
Mouse   258 ------------LRLGLDGASVPLGAAQWGELKTTAKEPSAGA---------GEVLLSISYLPAA 301

  Fly   460 GRLSVEIIKGSQFRSLSLNK--APDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVA 522
            .||.|.:||.....|....:  ..|..|| |.:....|::.:.:|...:.:.||::.|...|::.
Mouse   302 NRLLVVLIKAKNLHSNQSKELLGKDVSVK-VTLKHQAQKLKKKQTKRAKHKINPVWNEMIMFELP 365

  Fly   523 LFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWHVL 583
            ...|...::.:.|..:.....:..:|..||||::||||. :||.::.:.|: ..:|.||.|
Mouse   366 DDLLRASSVELEVLGQGEEGPSCELGHCSLGLHASGSER-SHWEEMLKNPR-RQIAMWHQL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 19/122 (16%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 39/140 (28%)
Syt13NP_109650.1 C2 160..277 CDD:301316 33/184 (18%)
C2B_Synaptotagmin-13 288..425 CDD:176052 39/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.