Sequence 1: | NP_001262249.1 | Gene: | Syt14 / 40544 | FlyBaseID: | FBgn0261086 | Length: | 648 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001019308.1 | Gene: | Pla2g4d / 78390 | MGIID: | 1925640 | Length: | 825 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 46/195 - (23%) |
---|---|---|---|
Similarity: | 79/195 - (40%) | Gaps: | 48/195 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 448 ELLLGLSYN---GVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQP 509
Fly 510 NPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFS---------------LGLNSSGS 559
Fly 560 EEVAHWADVCEMPKGEMLAR--W---------HVLVDSXFEQLGQSSGRSGKALRKLSLAAFKDR 613
Fly 614 613 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Syt14 | NP_001262249.1 | C2A_Synaptotagmin-14_16 | 291..413 | CDD:176035 | |
C2B_Synaptotagmin-14_16 | 446..584 | CDD:176053 | 37/164 (23%) | ||
Pla2g4d | NP_001019308.1 | C2_cPLA2 | 32..151 | CDD:176001 | 30/133 (23%) |
Patatin_and_cPLA2 | 278..814 | CDD:299702 | |||
PLAc | 283..758 | CDD:214474 | |||
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q86XP0 | 339..340 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1028 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |