DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and syt3

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001186849.1 Gene:syt3 / 779540 XenbaseID:XB-GENE-956378 Length:544 Species:Xenopus tropicalis


Alignment Length:634 Identity:140/634 - (22%)
Similarity:241/634 - (38%) Gaps:170/634 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TIEVTTLLGAFFGVLVLLLLLFLFISRKCCFHYRHAINCCDERHLAVKCVQKITRKRRYENTSSD 81
            ::.:.:::..|.|  ::||.:.||:|.|.|:                       ...|.:.:|..
 Frog    54 SVSLLSVIVTFCG--IVLLGVSLFVSWKLCW-----------------------IPWRDKGSSQT 93

  Fly    82 SEEDILRRLRWHQQHQLGEKPGGYGLGISQANPLTAQSFNYHQAGASADLQRVTVSRDPLAIAER 146
            ..:|.......|..|        ||                       ||....|...| .:.||
 Frog    94 QRKDHGHHGHLHHSH--------YG-----------------------DLLADRVELGP-EMPER 126

  Fly   147 GKVGIPSSHSECS---SNDSMEVSVDSHTGVLTGLSKATTTVPHPATAFRNPCGEHRAKTQALRY 208
            ..:.: .|:.|.:   |..|.::.|||.       ....:.:|:                 |..:
 Frog   127 SYLDM-DSYPETNIKISQTSPDIPVDSQ-------PPKESQIPY-----------------AQSH 166

  Fly   209 QHRVNVA----APPKLDKERDNVLVVPMVNAYSINNNNNSITTSNNHPS-SNNNDDEPLFDTS-- 266
            |...|:|    ||.       ||....:..|...:.....:|...:.|. |.:.|::|...||  
 Frog   167 QQVANIAPANVAPA-------NVAPANVAPANRYSTLPRPMTQQLSSPDFSGHVDEKPEQATSIG 224

  Fly   267 ----DLRSIKSDDLLVGVDQKEPAVQRGPIELELSLLYDAPMRKMTVHVMQAKNLPPLGSGQTTH 327
                :|...:|.|..:   :|:.|...|.|...|...|::  .::.|.:::|..||...:...:.
 Frog   225 QIKPELYKQRSADAEM---KKQEATSCGRISFILRYAYNS--EQLVVKILKALELPAKDANGFSD 284

  Fly   328 TQVRMLMLPSKKQKLKTKI-RSGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGE 391
            ..|:|.:||.:|:|.:||: |...||.:.|:|..: |...::.|..|...:|..:|..:..|||:
 Frog   285 PYVKMYLLPDRKKKFQTKVHRKTLNPIFNETFHFN-VPFNELQNRKLHFSIYDFDRFSRHDLIGQ 348

  Fly   392 AYV------SFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSESAGSTSSMQHGGVSELL 450
            ..:      |.||.    ||.:|               .|:|. |.||.|         .:.|:.
 Frog   349 VVLDNLLEFSNATD----ETPIW---------------RDILE-ASSEKA---------DLGEIN 384

  Fly   451 LGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKE 515
            ..|.|....|||:..|||.:..:::.|....|.|||..::.. |:.:.:.||||::...||.:.|
 Frog   385 FSLCYLPTAGRLTATIIKATNLKAMDLTGFSDPYVKASLICE-GRRLKKRKTSIKKNTLNPTYNE 448

  Fly   516 TFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNS--SGSEEVAHWADVCEMPKGEMLA 578
            ...|.:....::.|:|.|:|.....:..||::|...:|.::  .|.|   ||.::...|: :.:.
 Frog   449 ALVFDIPNENMDHVSLTIAVMDYDCIGHNEVIGMCRVGSDADMQGRE---HWNEMLANPR-KPIE 509

  Fly   579 RWHVLVDSXFEQLGQSSGRSGKALRKLSLAAFKDRSREKSSKESRLEEN 627
            .||.||:.             |||.     :|..:|.....|.|.:.:|
 Frog   510 HWHQLVEE-------------KALN-----SFMTKSPPPRDKPSIVVDN 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 34/128 (27%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 38/139 (27%)
syt3NP_001186849.1 C2A_Synaptotagmin-1-5-6-9-10 248..372 CDD:176031 36/145 (25%)
C2B_Synaptotagmin-3-5-6-9-10 381..514 CDD:176048 38/137 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.