DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and Syt14

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_008768117.1 Gene:Syt14 / 684293 RGDID:1592654 Length:859 Species:Rattus norvegicus


Alignment Length:377 Identity:151/377 - (40%)
Similarity:221/377 - (58%) Gaps:30/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SINNNNNSITTSNNHPSSNN---NDDEPLFDTS-----DLRSIKSDDLLVGVDQKEPAVQRGPIE 293
            |.|...:..:|.:...|.:|   .||.|...|:     |:.:..|...|......||..:.|  .
  Rat   486 SFNKCPSEGSTGHEAESYHNKGYEDDVPSDSTAVLSPEDMSAQGSASQLPKPFDPEPEAKYG--T 548

  Fly   294 LELSLLYDAPMRKMTVHVMQAKNLPPLGSGQTTHTQVRMLMLPSKKQKLKTKIRSGENPQYMESF 358
            |:::..||:..:|:.|.|....::|..........||.:::||.|||:.||.|:.|..|.:.|:|
  Rat   549 LDVTFDYDSERQKLLVTVTAVTDIPTYNRTGGNSWQVHLVLLPIKKQRAKTSIQRGPCPVFTETF 613

  Fly   359 LLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGST 423
            ..:.|..|.:.|..:|.||||..|::||:::||.......::|:.:.:|.:.|||....||..|.
  Rat   614 KFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPVILEPSYNPSGCDSQ 678

  Fly   424 SDLLSLARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAP------- 481
            ..|..::..:|..|..|::||.|.|:|:||.||..|||||.|:||||.|::|:.|:.|       
  Rat   679 VSLSEVSCGDSTSSCQSLEHGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNGLFCCL 743

  Fly   482 ------------DTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMIS 534
                        |||||:.:::|:|||:|:.|||.|||||||::||||.||||||||:||||::|
  Rat   744 KHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSTRRGQPNPVYKETFVFQVALFQLSDVTLILS 808

  Fly   535 VYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWHVLVDS 586
            ||.||.||:.||:||.||||||||.||:.||:.:.| .||:.:.|||.|::|
  Rat   809 VYNKRSMKRKEMIGWISLGLNSSGEEELRHWSAMKE-SKGQQVCRWHALLES 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 37/121 (31%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 86/156 (55%)
Syt14XP_008768117.1 C2A_Synaptotagmin-14_16 545..668 CDD:176035 38/122 (31%)
C2B_Synaptotagmin-14_16 701..857 CDD:176053 85/154 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 160 1.000 Domainoid score I3955
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 297 1.000 Inparanoid score I2639
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D339484at33208
OrthoFinder 1 1.000 - - FOG0002721
OrthoInspector 1 1.000 - - otm44512
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46129
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2510
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.