DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and Syt10

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_113854.1 Gene:Syt10 / 60567 RGDID:62041 Length:523 Species:Rattus norvegicus


Alignment Length:442 Identity:94/442 - (21%)
Similarity:174/442 - (39%) Gaps:97/442 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 RAKTQALRYQHRVNVAAPPKLDKERDNVLVVPMVNAYSINNNNNSITTSNNHPSSNNNDDEPLFD 264
            :|...|::..|     ..|.:..|....|...::....:.......|:|:.|.|...:....:  
  Rat   125 KAIEPAIKISH-----TSPDIPAEVQTALKEHLIKHARVQRQTTDPTSSSRHNSFRRHLPRQM-- 182

  Fly   265 TSDLRSIKSDDLLVGVDQKEPAVQRGPI-------------------------------ELELSL 298
                 ::.|.|..:|.   ||.:|||..                               :|..:|
  Rat   183 -----NVSSVDFSMGT---EPVLQRGETRTSIGRIKPELYKQKSVDSEGNRKDDVKTCGKLNFAL 239

  Fly   299 LYDAPMRKMTVHVMQAKNLPPLGSGQTTHTQVRMLMLPSKKQKLKTKI-RSGENPQYMESFLLHR 362
            .||.....:.|.:::|.:||......|:...|::.:||.:|:|.:|:: |...||.:.|.|....
  Rat   240 QYDYENELLVVKIIKALDLPAKDFTGTSDPYVKIYLLPDRKKKFQTRVHRKTLNPLFDELFQFPV 304

  Fly   363 VNPEDVNNMGLRVRLYGCERLRKERLIGEAYVS--FATVDLELETNLWLPLEPRNTSSGLGSTSD 425
            |. :.::|..|...:|..:|..:..:|||..:.  |...||..|..:|..:.             
  Rat   305 VY-DQLSNRKLHFSIYDFDRFSRHDMIGEVILDNLFEVSDLSREATVWKDIH------------- 355

  Fly   426 LLSLARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMV 490
                     ..:|.|:..|   |::..|.|....||:::.:||....:::.:..:.|.|||:.::
  Rat   356 ---------CATTESIDLG---EIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLM 408

  Fly   491 SSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLN 555
            .. |:.:.:.||:.::...||::.|...|.:....::.|:|.|:|.....:..||::|....||:
  Rat   409 CE-GRRLKKRKTTTKKNTLNPVYNEAIIFDIPPENVDQVSLCIAVMDYDRVGHNEVIGVCRTGLD 472

  Fly   556 SSGSEEVAHWADVCEMPKGEMLA-------RWHVLVD-----SXFEQLGQSS 595
            :.|... .||        .||||       .||.|::     :.|:..|..|
  Rat   473 AEGLGR-DHW--------NEMLAYHRKPITHWHPLLELPGRATSFDSQGSCS 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 33/155 (21%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 36/144 (25%)
Syt10NP_113854.1 Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681 13..35
C2A_Synaptotagmin-1-5-6-9-10 231..356 CDD:176031 33/147 (22%)
C2B_Synaptotagmin-3-5-6-9-10 365..498 CDD:176048 37/145 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.