DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and SYT13

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_065877.1 Gene:SYT13 / 57586 HGNCID:14962 Length:426 Species:Homo sapiens


Alignment Length:419 Identity:94/419 - (22%)
Similarity:165/419 - (39%) Gaps:79/419 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 RAKTQALRYQHRVNV------AAPPKLDKERDNVLVVPMVNAYSINNNNNSITTSNNHPSSNNND 258
            :||...|....:.||      ..|..|.|..|.....|.|.|..:.|..:....|...|::..:.
Human    50 KAKPSLLGSAQQFNVKKSTEPVQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASP 114

  Fly   259 DEPLFDTSDLRSIKSDDLLV----GV-----------DQKEPAVQRGPIELELSLLYDAPMRKMT 308
            ..|  :.|.|:...:::|.:    ||           .:|..:..:.| :|...|.||....::.
Human   115 QPP--NDSRLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAP-KLHYCLDYDCQKAELF 176

  Fly   309 VHVMQAKNLPPLG----------SGQTTHTQVRMLMLPSKKQKLKTKIRSGENPQYMESFLLHRV 363
            |..::|......|          :.:|...:.:..:   ||::|.|....|         |:..:
Human   177 VTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTAL---KKRQLHTTWEEG---------LVLPL 229

  Fly   364 NPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGSTSDLLS 428
            ..|::....|.:.|..|:|..:..:.||               |.|.|:..:...|.....:|.:
Human   230 AEEELPTATLTLTLRTCDRFSRHSVAGE---------------LRLGLDGTSVPLGAAQWGELKT 279

  Fly   429 LARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNK--APDTYVKMVMVS 491
            .|:..|||:         .|:||.:||.....||.|.:||.....|....:  ..|..|| |.:.
Human   280 SAKEPSAGA---------GEVLLSISYLPAANRLLVVLIKAKNLHSNQSKELLGKDVSVK-VTLK 334

  Fly   492 SIGQEISRAKTSIRRGQPNPLFKETFAFQVA--LFQLNDVTLMISVYAKRHMKKNEMVGWFSLGL 554
            ...:::.:.:|...:.:.||::.|...|::.  |.|.:.|.|  .|..:....::..:|..||||
Human   335 HQARKLKKKQTKRAKHKINPVWNEMIMFELPDDLLQASSVEL--EVLGQDDSGQSCALGHCSLGL 397

  Fly   555 NSSGSEEVAHWADVCEMPKGEMLARWHVL 583
            ::||||. :||.::.:.|: ..:|.||.|
Human   398 HTSGSER-SHWEEMLKNPR-RQIAMWHQL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 25/131 (19%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 41/142 (29%)
SYT13NP_065877.1 C2A_Synaptotagmin-13 160..277 CDD:176059 26/144 (18%)
C2B_Synaptotagmin-13 288..425 CDD:176052 41/151 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.