DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and syt6b

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_021328166.1 Gene:syt6b / 562928 ZFINID:ZDB-GENE-090601-3 Length:504 Species:Danio rerio


Alignment Length:468 Identity:107/468 - (22%)
Similarity:197/468 - (42%) Gaps:83/468 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ASADLQRVTVSRDPLAIAERGKVGIPSSHSECSSNDSMEVSVDSHTGVLTGLSKATTTVPHPATA 191
            |..|:......:||....|   ..:..||:.......:::|:..|....|.:|:.||   .||::
Zfish    81 ALRDIMAADKLKDPGNFLE---AAVKISHTSPDIPADVQLSMKDHLLRRTRISRQTT---EPASS 139

  Fly   192 FRNPCGEHRA-KTQALRYQHRVNVAAPPKLDKERD--NVLVVPMVNAYSINNNNNSI---TTSNN 250
            .|     |.: |....|..|.|.     .||:..:  :|...|...|.|:......:   :|...
Zfish   140 NR-----HSSFKKHLPRQMHHVT-----SLDRGSEFLDVEDHPSCTAASLGRIQPELYKQSTMEA 194

  Fly   251 HPSSNNNDDEPLFDTSDLRSIKSDDLLVGVDQKEPAVQRGPIELELSLLYDAPMRKMTVHVMQAK 315
            ..||.|:.|:...                             ::..||.||.....:.|.:::|.
Zfish   195 EDSSKNDTDKSCG-----------------------------KINFSLKYDYEGELLLVTILKAF 230

  Fly   316 NLPPLGSGQTTHTQVRMLMLPSKKQKLKTKI-RSGENPQYMESFLLHRVNPEDVNNMGLRVRLYG 379
            :||......::...|::.:||.:|:|.:|:: |...||.:.|:|.. .|..|::.:..|.:.::.
Zfish   231 DLPAKDLCGSSDPYVKIYLLPDRKRKFQTRVHRKTLNPTFDETFQF-PVPYEELGSRKLHLSVFD 294

  Fly   380 CERLRKERLIGEAYVS--FATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSESAGSTSSMQ 442
            .:|..:..:|||..:.  |...||..||::|..::                .|.|||.       
Zfish   295 FDRFSRHDMIGEVILENLFEVSDLSRETSIWKDIQ----------------YATSESV------- 336

  Fly   443 HGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRG 507
              .:.|::..|.|....|||::.:||....:::.:....|.|||:.::.. |:.:.:.||||::.
Zfish   337 --DLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLICD-GRRLKKKKTSIKKN 398

  Fly   508 QPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMP 572
            ..||.:.|...|.:....::.|:|.|||.....:..||::|...:|:::.|... .||.::...|
Zfish   399 TLNPTYNEAIIFDIPPENMDQVSLHISVMDYDLVGHNEIIGVCRVGIHAEGLGR-DHWNEMLAYP 462

  Fly   573 KGEMLARWHVLVD 585
            : :.:|.||.||:
Zfish   463 R-KPIAHWHPLVE 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 32/124 (26%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 37/137 (27%)
syt6bXP_021328166.1 C2A_Synaptotagmin-1-5-6-9-10 206..330 CDD:176031 32/169 (19%)
C2B_Synaptotagmin-3-5-6-9-10 339..472 CDD:176048 37/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.