DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and syt4

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_956242.1 Gene:syt4 / 335357 ZFINID:ZDB-GENE-030131-7297 Length:439 Species:Danio rerio


Alignment Length:308 Identity:79/308 - (25%)
Similarity:138/308 - (44%) Gaps:35/308 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 PAVQR------GPIELELSLLYDAPMRKMTVHVMQAKNLPPLG-SGQTTHTQVRMLMLPSKKQKL 342
            |||::      |...|..|:.|:...:...||:.:|..|.|.. ...|:...:::.:||.||.|:
Zfish   155 PAVEKSQDKEGGLGTLFFSVEYNFEKKAFMVHIKEAHGLSPTDEQSLTSDPYIKLTLLPEKKHKV 219

  Fly   343 KTKI-RSGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETN 406
            ||:: |...:|.:.|:|..:.:....|:.:.|...:...:|..::.:|||..|..|.:||.    
Zfish   220 KTRVLRKTLDPAFDETFSFYGIPFARVSQLALHFMVLSFDRFSRDEVIGETLVPLADIDLS---- 280

  Fly   407 LWLPLEPRNTSSGLGSTSDLLSLARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQ 471
                 |.|...|     .|::......|||.         .||||.|.|...|..|:|.::|...
Zfish   281 -----EGRVLMS-----RDIIKKNIRRSAGR---------GELLLSLCYQSTTSTLTVVVLKARH 326

  Fly   472 FRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQ-LNDVTLMISV 535
            ......:...|.|||:.:... .:.:.:.||.:::..|||:|.|.|.|.:.... |.|.::.:.:
Zfish   327 LPKADSSGPSDPYVKVNLFQG-KKRVCKKKTHVKKCAPNPVFNELFVFDLPSEDGLRDTSVELLL 390

  Fly   536 YAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWHVL 583
            .......:..::|...||.:|.|:.. .||.::|:.|: ..:|:||.|
Zfish   391 LDSDRTSRTPVIGRLVLGTSSPGTAG-EHWREICDHPR-RQIAKWHAL 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 30/123 (24%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 38/139 (27%)
syt4NP_956242.1 C2A_Synaptotagmin-4-11 166..292 CDD:176034 35/139 (25%)
C2B_Synaptotagmin-4 301..437 CDD:176049 38/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.