DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and Syt14

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_006497318.1 Gene:Syt14 / 329324 MGIID:2444490 Length:857 Species:Mus musculus


Alignment Length:377 Identity:151/377 - (40%)
Similarity:219/377 - (58%) Gaps:30/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SINNNNNSITTSNNHPSSNN---NDDEPLFDTS-----DLRSIKSDDLLVGVDQKEPAVQRGPIE 293
            |.|...:..:|.:...|.:|   .||.|...|:     |:.:..|...|......||..:.|  .
Mouse   484 SFNKCPSEGSTGHEAESYHNKGYEDDVPSDSTAVLSPEDMSAQGSSSQLPKPFDPEPEAKYG--T 546

  Fly   294 LELSLLYDAPMRKMTVHVMQAKNLPPLGSGQTTHTQVRMLMLPSKKQKLKTKIRSGENPQYMESF 358
            |:::..||:..:|:.|.|....::|..........||.:::||.|||:.||.|:.|..|.:.|:|
Mouse   547 LDVTFDYDSERQKLLVTVTAVTDIPTYNRTGGNSWQVHLVLLPIKKQRAKTSIQRGPCPVFTETF 611

  Fly   359 LLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGST 423
            ..:.|..|.:.|..:|.||||..|::||:::||.......::|:.:.:|.:.|||....||..|.
Mouse   612 KFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPVILEPSYNPSGCDSQ 676

  Fly   424 SDLLSLARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAP------- 481
            ..|...:..:|..|..|:|||.|.|:|:||.||..|||||.|:||||.|::|:.|:.|       
Mouse   677 VSLSEASCGDSTSSCQSLQHGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNGLFCCL 741

  Fly   482 ------------DTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMIS 534
                        |||||:.:::|:|||:|:.|||.|||||||::||||.||||||||:||||::|
Mouse   742 KHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSTRRGQPNPVYKETFVFQVALFQLSDVTLILS 806

  Fly   535 VYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWHVLVDS 586
            ||.:|.||:.||:||.||||||||.||:.||..:.| .||:.:.|||.|::|
Mouse   807 VYNRRSMKRKEMIGWISLGLNSSGEEELRHWTAMKE-SKGQQVCRWHALLES 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 37/121 (31%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 85/156 (54%)
Syt14XP_006497318.1 C2A_Synaptotagmin-14_16 543..666 CDD:176035 38/122 (31%)
C2B_Synaptotagmin-14_16 699..855 CDD:176053 84/154 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 160 1.000 Domainoid score I4043
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 306 1.000 Inparanoid score I2607
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002721
OrthoInspector 1 1.000 - - otm42447
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46129
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5537
SonicParanoid 1 1.000 - - X2510
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.950

Return to query results.
Submit another query.