DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and Sytl5

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_848016.1 Gene:Sytl5 / 302538 RGDID:631342 Length:753 Species:Rattus norvegicus


Alignment Length:582 Identity:117/582 - (20%)
Similarity:206/582 - (35%) Gaps:148/582 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 EKPGGYGLGISQANPLTAQSFNYHQAGASADLQRVTVSRDPLAIAERGKVGIPSSHSECSSNDSM 164
            |....|.|.:...|   .|||.    ..|...:..|.|.| |...|.|: |.|.  ..| ||..:
  Rat   205 ESGRSYSLDLDNQN---LQSFK----SVSGSDRGSTTSSD-LTDQEAGR-GAPK--GSC-SNGGI 257

  Fly   165 EVSVDSHTGVLTGLSKATTTVPHPATAFRN--PCGEHRAKTQALRYQHRVNVAAPP-------KL 220
            .|:..|.    ...:::.|::......|.|  ......:.::.|...||.|.:..|       .|
  Rat   258 PVTQRSP----APSARSVTSISSREHGFENSMALATIESISEELTKSHRRNTSGTPSIAVSGTSL 318

  Fly   221 DKERDNVLVVPMVNAYSINNNNNSITTSNNHPSSNNNDDEPLFDTSD---------------LRS 270
            ..||.. ..:.:..:::.:..:.|...|.:.|.:.:.|...|.||.|               |.|
  Rat   319 SSERSR-SELDLSESFAEDLEDTSSIRSRSVPGALDKDLNSLEDTEDGVDLVSSRFSANTHSLAS 382

  Fly   271 IKSDDLLVGVDQKEPAVQ-----------------------------RGPIELELSLLYDAPMRK 306
            ..|.....|.|:|...:.                             .|.|.|.:|..|..  ..
  Rat   383 GLSTSSQAGSDRKRSYLHVPDADSDTTSLNSMMSVYSETGDYGNVKVTGEILLHISYCYKT--GG 445

  Fly   307 MTVHVMQAKNLPPLG--SGQTTHTQVRMLMLPSK--KQKLKTKIRSGENPQYMESFLLHRVNPED 367
            :.:.|...:|| .:|  ..|.|...|:..:||.|  ..|.|||||:|.||::.|: |.:.::...
  Rat   446 LYIFVKNCRNL-AIGDEKKQRTDAYVKSYLLPDKTRNNKRKTKIRTGTNPEFNET-LKYTISHTQ 508

  Fly   368 VNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARS 432
            :....|::.::..:|..:...:||..::|.:.:.|...:.|..|:|:            :.||  
  Rat   509 LETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPK------------VELA-- 559

  Fly   433 ESAGSTSSMQHGGVSELLLGLSY-------------------------------NGVTGRLSVEI 466
                ...|:|:.|  ||.:.|.|                               :|  |.|.|.|
  Rat   560 ----PDISLQYKG--ELTIVLRYIPPEENLIFPVEQPQGKKIFKKGKKKESPAISG--GILEVFI 616

  Fly   467 IKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALF--QLNDV 529
            .:.....::......|::||..::.. ..:.::.||::.:...||.:...|.|. .|:  .:.:.
  Rat   617 KEAKNLTAVKAGGTSDSFVKGYLLPD-DNKATKHKTAVVKKSVNPQWNHVFIFS-GLYPQDIQNA 679

  Fly   530 TLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAH-----WADVCEMPKGEMLARWHVLVDS 586
            .|.::::.|.....|..:|    |:..:....::|     |.|    .:||....|..:.|:
  Rat   680 CLELTIWDKEAFSSNIFLG----GVRLNSGSGISHGKAVDWMD----SRGEEQRLWQKMADN 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 33/125 (26%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 30/175 (17%)
Sytl5NP_848016.1 FYVE_Slp5 62..108 CDD:277305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..188
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..283 18/74 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..359 11/61 (18%)
C2A_SLP-4_5 430..553 CDD:175995 33/126 (26%)
C2B_SLP_1-2-3-4 567..745 CDD:175987 32/181 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.