DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and Pla2g4e

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_017447688.1 Gene:Pla2g4e / 296091 RGDID:1310595 Length:900 Species:Rattus norvegicus


Alignment Length:267 Identity:55/267 - (20%)
Similarity:92/267 - (34%) Gaps:89/267 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 RMLMLPSKKQKLKTKIRSGENPQYMESFLLHRVNPED--------VNNM-GLRVRLYGCERLRKE 386
            |:|.|..:.::....:.||: |: :||  .|..:..|        |.:| ..|.::.|.||...|
  Rat     6 RLLSLRQEPRQETPSVDSGK-PE-LES--RHDASEADACLGFPLPVRHMPSRRWQVLGAERHGNE 66

  Fly   387 RLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSESAGSTSSMQHGGVSELLL 451
            |       :.|.:.||:.|      ....||........:.:.||.|.    ||..|        
  Rat    67 R-------AAACLTLEMST------IGEETSQNKQCQKSMWAAARQEG----SSPCH-------- 106

  Fly   452 GLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKET 516
                     .|:|.||.....|...:....|.:|.:.:.::..:::   :|......|:|.:.|:
  Rat   107 ---------LLTVRIISMKNVRQADILSQTDCFVTLWLPTASQKKL---RTRTISNCPHPEWNES 159

  Fly   517 FAFQV--------------------------ALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLN 555
            |.||:                          .|:.|:.:.|.    .|.|:|         ..||
  Rat   160 FTFQIQTRVKNVLEFSICDEDTLTQSDHLLTVLYDLSKLCLR----NKTHVK---------FPLN 211

  Fly   556 SSGSEEV 562
            ..|.||:
  Rat   212 PEGMEEL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 22/90 (24%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 25/143 (17%)
Pla2g4eXP_017447688.1 C2_cPLA2 107..215 CDD:176001 22/123 (18%)
cPLA2_C2 247..354 CDD:408472
Patatin_and_cPLA2 353..895 CDD:416256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.