DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and Syt2

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_038946276.1 Gene:Syt2 / 24805 RGDID:3804 Length:499 Species:Rattus norvegicus


Alignment Length:306 Identity:89/306 - (29%)
Similarity:156/306 - (50%) Gaps:32/306 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 GVDQKEPAVQRGPIELELSLLYDAPMRKMTVHVMQAKNLPPLGSGQTTHTQVRMLMLPSKKQKLK 343
            |.::|||. ..|  :|:.||.||....::||.|:||..||.|..|.|:...|::.:||.||:|.:
  Rat   211 GEEEKEPE-NLG--KLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYE 272

  Fly   344 TKI-RSGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETNL 407
            ||: |...||.:.|:|.. :|..:::....|.:.:|..:|..|..:|||..|...||||......
  Rat   273 TKVHRKTLNPAFNETFTF-KVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEE 336

  Fly   408 WLPLEPRNTSSGLGSTSDLLSLARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQF 472
            |..|:        |...:     ..|..|           ::...|.|....|:|:|.|::....
  Rat   337 WRDLQ--------GGEKE-----EPEKLG-----------DICTSLRYVPTAGKLTVCILEAKNL 377

  Fly   473 RSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMISVYA 537
            :.:.:....|.|||:.::.: |:.:.:.||::::...||.|.|:|:|::...|:..|.::::|..
  Rat   378 KKMDVGGLSDPYVKIHLMQN-GKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLD 441

  Fly   538 KRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWHVL 583
            ...:.|||.:|...:|.|::|: |:.||:|:...|: ..:|:||.|
  Rat   442 YDKLGKNEAIGKIFVGSNATGT-ELRHWSDMLANPR-RPIAQWHSL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 43/122 (35%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 38/138 (28%)
Syt2XP_038946276.1 Syt2_N 81..193 CDD:409249
C2A_Synaptotagmin-1-5-6-9-10 219..341 CDD:176031 43/124 (35%)
C2B_Synaptotagmin-1 351..486 CDD:176047 39/149 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.