DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and Pla2g4b

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_663353.3 Gene:Pla2g4b / 211429 MGIID:2384819 Length:791 Species:Mus musculus


Alignment Length:125 Identity:27/125 - (21%)
Similarity:45/125 - (36%) Gaps:37/125 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 LSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQV----- 521
            |:|.:::.|...|..|..:.|.||.:.:.::....:   :|...:...||::.:.|.|::     
Mouse    20 LTVRVLRASGLPSKDLVTSSDCYVTLNLPTASSHTL---QTRTVKNSRNPVWNQNFHFRIHRQLK 81

  Fly   522 ------------------ALFQLNDV-TLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEV 562
                              .|..|.|| ||.|....:.          ||||....|..||
Mouse    82 NVMELKVFDHDLVTRDDPVLSVLFDVGTLQIGTQRQS----------FSLGTQEKGCLEV 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035
C2B_Synaptotagmin-14_16 446..584 CDD:176053 27/125 (22%)
Pla2g4bNP_663353.3 C2_cPLA2 19..137 CDD:176001 27/125 (22%)
Patatin_and_cPLA2 250..779 CDD:299702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.