DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and D2023.3

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001256374.1 Gene:D2023.3 / 183945 WormBaseID:WBGene00008407 Length:222 Species:Caenorhabditis elegans


Alignment Length:180 Identity:43/180 - (23%)
Similarity:84/180 - (46%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 LPLEPRNTSSGL--GSTSDLLSLARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQ 471
            ||:.|...|:|:  |...|....:..::.|...|....|..|:|:||.|:.....:||.|.|.| 
 Worm    44 LPVSPSMHSNGISRGHNGDSRRSSMVDATGRFCSQPMSGSPEILVGLCYDDKHEVVSVCIEKAS- 107

  Fly   472 FRSLSLNKA--PDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMIS 534
              ||..:.|  ||::::::.:.....|:||.||...:....|::......:.:..::...|:.:.
 Worm   108 --SLGSDTAHPPDSFIRIIGLDEFSTELSRHKTDTVKHSTQPVYSHHCTMRFSKDKVETSTVRVE 170

  Fly   535 VYAKRH-MKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWHVL 583
            |:.... :::...:|..|:|..||..:...||..:.: ..|..:::||.:
 Worm   171 VWTVTGILRRKVQIGSISIGFASSTPDANEHWQQMMQ-GAGITVSKWHAI 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 2/3 (67%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 33/141 (23%)
D2023.3NP_001256374.1 C2 84..219 CDD:387358 33/138 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002721
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2510
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.