DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt14 and sytl3

DIOPT Version :9

Sequence 1:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_021324208.1 Gene:sytl3 / 101882017 ZFINID:ZDB-GENE-040724-150 Length:581 Species:Danio rerio


Alignment Length:387 Identity:83/387 - (21%)
Similarity:163/387 - (42%) Gaps:66/387 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SNDSMEVSVDSHTGVLTGLSKATTTVPHPATAFRNPCGEHRAKTQALRYQHRVNVAAPPKLDKER 224
            |.:::..||.:|   :..|||:...:...|       |:.......:.|..|.:: :...:::..
Zfish   193 SMENLVASVSAH---IKKLSKSQNDLSEVA-------GQLTVDHGHMMYSRRKSL-SDGAINRAL 246

  Fly   225 DNVLVVPMVN-AYSINNNNNSITTSNNHPSSNNNDDEPLFDTSDLRSIKSDDLLVGVDQKEPAVQ 288
            ..|..:|::: |.|.:.:...:|..:...:|..:||:           :..:...|:|.   .:.
Zfish   247 CKVPSLPILSTAQSTSTSTLCLTDDDVSSTSAYSDDQ-----------RDSNSSTGMDS---VLF 297

  Fly   289 RGPI----ELELSLLYDAPMRKMTVHVMQAKNLPPLGSGQTTHTQVRMLMLPSK--KQKLKTKIR 347
            ...|    |:|:.|.|:.....:.:.:...:||....:.:..|..|.:.:||.|  ..|:||.:|
Zfish   298 ENTISVTGEIEVVLAYNNRTSCLEITIKACRNLMFRDTKKKCHPYVNVCLLPKKCHNFKMKTAVR 362

  Fly   348 SGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLE---LETNLWL 409
            .|:||.|.|:|.. .::.:.:::..|::.::....|::...:||..:..|.:|||   .:.:|..
Zfish   363 KGKNPVYNETFTC-VLSADLLSSAVLQLSVWHSRGLKRRLFLGETLIRLADMDLEDTDSQRSLCC 426

  Fly   410 PLEPRNTSSG----LGSTSDLLSL-ARSESAGSTSSMQHGGVSELLLG------LSYNGVTGRLS 463
            .|.|:....|    |..||.||.: |:..:....::..||    :|||      :.:..|:..||
Zfish   427 KLNPKAPQLGGDAELQFTSVLLLIQAQFHTLPHNNTQTHG----VLLGAPGQLTVLFTDVSKLLS 487

  Fly   464 VEIIKGSQF-------------RSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPL 512
            |.  |.:.|             |..|..|..|..::|...|...||:.:|..::...:.|.|
Zfish   488 VS--KTAHFEGILCLPGHRELVRKTSALKKTDGSIRMSFSSLSQQELQQATLTLNLWEKNCL 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 32/130 (25%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 20/86 (23%)
sytl3XP_021324208.1 PHD_SF 27..134 CDD:328929
FYVE_like_SF 73..120 CDD:333710
C2 304..429 CDD:326325 30/125 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.