DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and DID2

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_012961.3 Gene:DID2 / 853906 SGDID:S000006435 Length:204 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:51/232 - (21%)
Similarity:97/232 - (41%) Gaps:48/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNARKA 73
            |::....::....:::....||.:|.....:||::....||:|..:|:                .
Yeast     2 SRNSAAGLENTLFQLKFTSKQLQKQANKASKEEKQETNKLKRALNENE----------------D 50

  Fly    74 INRIYTSKAHLNSIQMQMKNQ-LSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKA 137
            |:|||.|.|      ::.||: |..|::|..:.   .|...:|:.|...:::..|..:.|.|.||
Yeast    51 ISRIYASNA------IRKKNERLQLLKLASRVD---SVASRVQTAVTMRQVSASMGQVCKGMDKA 106

  Fly   138 ---------GIIEEMLDETMDSLEESEELEEEASKEVDKVLWEITDGKLGE--APLPPEATPADK 191
                     .:|.:..::..:.|:.|..:.|:.....|.:|  :.:.|:.|  :.:..|.....|
Yeast   107 LQNMNLQQITMIMDKFEQQFEDLDTSVNVYEDMGVNSDAML--VDNDKVDELMSKVADENGMELK 169

  Fly   192 ASASAARV------EAEQDDEEGEELQEMQSRLASLR 222
            .||....|      |...|||:.::|.:   ||.:||
Yeast   170 QSAKLDNVPEIKAKEVNVDDEKEDKLAQ---RLRALR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 37/180 (21%)
DID2NP_012961.3 Did4 21..204 CDD:227778 50/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.