DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and DID4

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_012924.2 Gene:DID4 / 853868 SGDID:S000001485 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:53/233 - (22%)
Similarity:116/233 - (49%) Gaps:23/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEI 67
            :||:..:  |:|::::....:.:...:|:|:.|.::.:::|:...:|::|:........:.||::
Yeast     7 VFGKNVT--PQERLKKNQRALERTQRELEREKRKLELQDKKLVSEIKKSAKNGQVAAAKVQAKDL 69

  Fly    68 VNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSK 132
            |..|..|.:....||.|.:|.::::...|:.::..|:.::|.:|..|...:..|:|..|..:..|
Yeast    70 VRTRNYIQKFDNMKAQLQAISLRIQAVRSSDQMTRSMSEATGLLAGMNRTMNLPQLQRISMEFEK 134

  Fly   133 EMMKAGIIEEMLDETMDSL--EESEELEEEASKEVDKVLWEI-----------TDGKLGEAPLPP 184
            :....|..:|.:||.:|::  :|.:| :|||.:.|:|||.||           ....:..||:..
Yeast   135 QSDLMGQRQEFMDEAIDNVMGDEVDE-DEEADEIVNKVLDEIGVDLNSQLQSTPQNLVSNAPIAE 198

  Fly   185 EATPADKASASAARVEAEQDDEEGEELQEMQSRLASLR 222
            .|....:...:.:......||       ::|:||.:|:
Yeast   199 TAMGIPEPIGAGSEFHGNPDD-------DLQARLNTLK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 42/181 (23%)
DID4NP_012924.2 Did4 38..229 CDD:227778 45/198 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.