DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and VPS24

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_012883.1 Gene:VPS24 / 853825 SGDID:S000001524 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:69/215 - (32%)
Similarity:128/215 - (59%) Gaps:4/215 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNARKAIN 75
            |||||.:.....:||.|..:::.:|.:...:.|.::.:|::|:|||..|..:.|||:....|..:
Yeast    12 DPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQINKQYD 76

  Fly    76 RIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGII 140
            |:|||:|.|:|::|::...:....::..:..|..:::.:.||||.|:|...|.::.||:||:|||
Yeast    77 RMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELEKELMKSGII 141

  Fly   141 EEMLDETMDSL-EESEELEEEASKEVDKVLWEITDGKLGEAPLPPEATPADKASASAARVEAEQD 204
            .||:|:||:|: :..||::|...:||:|::.:.|:.|.......|....|  |:.....:..|:.
Yeast   142 SEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFKNVDQVPTVELA--ANEEEQEIPDEKV 204

  Fly   205 DEEGEEL-QEMQSRLASLRS 223
            |||.:.: .||:.||.:|::
Yeast   205 DEEADRMVNEMRERLRALQN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 53/169 (31%)
VPS24NP_012883.1 Did4 26..224 CDD:227778 63/199 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341330
Domainoid 1 1.000 108 1.000 Domainoid score I1423
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6368
Inparanoid 1 1.050 125 1.000 Inparanoid score I1283
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoFinder 1 1.000 - - FOG0004091
OrthoInspector 1 1.000 - - oto99805
orthoMCL 1 0.900 - - OOG6_103236
Panther 1 1.100 - - LDO PTHR10476
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1644
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.