DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and Chmp2b

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_081155.1 Gene:Chmp2b / 68942 MGIID:1916192 Length:213 Species:Mus musculus


Alignment Length:201 Identity:51/201 - (25%)
Similarity:112/201 - (55%) Gaps:5/201 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNARKAI 74
            |...:.::|...::|.....:.|...:::::|::::..:|:.|:..:::.|.:|||::|:.||..
Mouse     8 KTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRKQK 72

  Fly    75 NRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGI 139
            .|.:...:.:.|:..|.|...|.:::||::..:.:.:||:...:...:....|::..||.||..:
Mouse    73 TRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEM 137

  Fly   140 IEEMLDETMDSLEESEELEEEASKEVDKVLWEI---TDGKLGEAPLPPEATPADKASASAARVEA 201
            .|||:::|:|.:.:..:.|||:...|::||.||   ..||:.:||....:.|:  ||.|.|.:..
Mouse   138 TEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPS--ASTSKATISD 200

  Fly   202 EQDDEE 207
            |:.:.:
Mouse   201 EEIERQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 44/171 (26%)
Chmp2bNP_081155.1 Snf7 16..185 CDD:397437 44/168 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..199 7/21 (33%)
MIT-interacting motif 201..211 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.