DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and Chmp3

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001348334.1 Gene:Chmp3 / 66700 MGIID:1913950 Length:224 Species:Mus musculus


Alignment Length:228 Identity:136/228 - (59%)
Similarity:179/228 - (78%) Gaps:9/228 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAK 65
            |||||:|..|.|||.|.||:.|||||...:|||||.|||||||||||:|.||:|..::.||:|||
Mouse     1 MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAK 65

  Fly    66 EIVNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDM 130
            |::.:|||::::|.||||:||:.|.|||||:.|||||||||||||::||||||:.||:...||::
Mouse    66 EMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMREL 130

  Fly   131 SKEMMKAGIIEEMLDETMDSLEESEELEEEASKEVDKVLWEITDGKLGEAPLP-----PEATPAD 190
            ||||||||||||||::|.:|:::.||:||.|..|:|::|:|||.|.||:||..     ||..|  
Mouse   131 SKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKAPSKVTDALPEPEP-- 193

  Fly   191 KASASAARVEAEQDDEEGEELQEMQSRLASLRS 223
             |.|.||..|.|::::| |:|:.||||||:|||
Mouse   194 -AGAMAASEEGEEEEDE-EDLEAMQSRLATLRS 224

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 106/173 (61%)
Chmp3NP_001348334.1 Intramolecular interaction with C-terminus. /evidence=ECO:0000250 2..113 72/110 (65%)
Snf7 18..187 CDD:397437 104/168 (62%)
Important for autoinhibitory function. /evidence=ECO:0000250 59..64 2/4 (50%)
Interaction with VPS4A. /evidence=ECO:0000250 151..224 35/76 (46%)
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 151..222 34/74 (46%)