DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and CHMP1B

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_065145.2 Gene:CHMP1B / 57132 HGNCID:24287 Length:199 Species:Homo sapiens


Alignment Length:214 Identity:48/214 - (22%)
Similarity:88/214 - (41%) Gaps:54/214 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNAR-KAINRIYTSKAHLNSIQMQMK 92
            :|.|..:...:||:..|..:|:|.||.:.:...|.|:..:..: :|:|.:..| |.::::..:::
Human    17 ELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMS-ARVDAVAARVQ 80

  Fly    93 NQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLDETMDSLE----- 152
                |....|.:.||               :||:::.|...:....:  |.:...||..|     
Human    81 ----TAVTMGKVTKS---------------MAGVVKSMDATLKTMNL--EKISALMDKFEHQFET 124

  Fly   153 ---ESEELEEEAS---------KEVDKVLWEITDGKLGEA--PLPPEATPADKASASAARVEAEQ 203
               :::::|:..|         .:||.:|.|:.|    ||  .|..|.......|...:...|||
Human   125 LDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMAD----EAGLDLNMELPQGQTGSVGTSVASAEQ 185

  Fly   204 DDEEGEELQEMQSRLASLR 222
            |        |:..|||.||
Human   186 D--------ELSQRLARLR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 37/177 (21%)
CHMP1BNP_065145.2 Snf7 49..189 CDD:419749 34/173 (20%)
Interaction with IST1 132..156 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..199 12/38 (32%)
Interaction with SPAST. /evidence=ECO:0000269|PubMed:15537668 174..199 11/31 (35%)
Interaction with VTA1 180..199 10/25 (40%)
Interaction with VPS4A, MITD1 and STAMBP. /evidence=ECO:0000269|PubMed:19129480 180..196 8/23 (35%)
Interaction with VPS4B 183..199 10/22 (45%)
MIT-interacting motif 186..196 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.