DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and chmp2ba

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001116769.1 Gene:chmp2ba / 569532 ZFINID:ZDB-GENE-070628-3 Length:216 Species:Danio rerio


Alignment Length:195 Identity:58/195 - (29%)
Similarity:108/195 - (55%) Gaps:7/195 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNARKAINRIYTS 80
            ::|.:.::|....|:.|...:::|:|.:::..:|:.|:..:|:.|.||||::|..||..||.|..
Zfish    14 IKEQSKELRGTQRQITRDRAALERQERQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAV 78

  Fly    81 KAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLD 145
            .:.:.|:..|.|...|.:::||::..:.:.:|.:...:...:....|:|..||.||.|:.|:||:
Zfish    79 SSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKRMDPKKTLQTMQDFQKENMKMGMTEDMLN 143

  Fly   146 ETMDSLEESEELEEEASKEVDKVLWEI---TDGKLGEAP----LPPEATPADKASASAARVEAEQ 203
            .|:|.:.:....|||....|::||.||   ..||:..||    :.|.|:||...:|:.:..|.|:
Zfish   144 STLDEIFDESADEEECQDIVNQVLDEIGIEISGKMVRAPSTGKILPGASPAKSKTATISDAEIER 208

  Fly   204  203
            Zfish   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 52/175 (30%)
chmp2baNP_001116769.1 Snf7 16..184 CDD:281366 51/167 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.