DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and chmp3

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_002937319.1 Gene:chmp3 / 548983 XenbaseID:XB-GENE-1005141 Length:681 Species:Xenopus tropicalis


Alignment Length:42 Identity:12/42 - (28%)
Similarity:21/42 - (50%) Gaps:7/42 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEE 42
            :|..|....||.:|.|:       |.|:.::.::.|..:|||
 Frog    57 LGYSGLPEKKDVRELVE-------KSGDLMEGELYSAMKEEE 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 6/25 (24%)
chmp3XP_002937319.1 RING-H2_RNF103 617..661 CDD:319387
RING-H2 finger (C3H2C3-type) 618..659 CDD:319387
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 222 1.000 Domainoid score I2540
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6368
Inparanoid 1 1.050 261 1.000 Inparanoid score I3023
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004091
OrthoInspector 1 1.000 - - oto104200
Panther 1 1.100 - - LDO PTHR10476
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1644
SonicParanoid 1 1.000 - - X5117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.