DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and CHMP3

DIOPT Version :10

Sequence 1:NP_649451.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_057163.1 Gene:CHMP3 / 51652 HGNCID:29865 Length:222 Species:Homo sapiens


Alignment Length:228 Identity:135/228 - (59%)
Similarity:176/228 - (77%) Gaps:11/228 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAK 65
            |||||:|..|.|||.|.||:.|||||...:|||||.|||||||||||:|.||:|..:|.|::|||
Human     1 MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAK 65

  Fly    66 EIVNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDM 130
            |::.:|||::::|.||||:||:.|.|||||:.|||||||||||||::||||||:.||:...||::
Human    66 EMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMREL 130

  Fly   131 SKEMMKAGIIEEMLDETMDSLEESEELEEEASKEVDKVLWEITDGKLGEAPLP-----PEATPAD 190
            ||||||||||||||::|.:|:::.||:||||..|:|::|:|||.|.||:||..     ||..|..
Human   131 SKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPG 195

  Fly   191 KASASAARVEAEQDDEEGEELQEMQSRLASLRS 223
            ..:||      |.::||.|.|:.||||||:|||
Human   196 AMAAS------EDEEEEEEALEAMQSRLATLRS 222

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_649451.1 Snf7 18..187 CDD:460896 107/173 (62%)
CHMP3NP_057163.1 Intramolecular interaction with C-terminus 2..113 72/110 (65%)
Snf7 18..187 CDD:460896 105/168 (63%)
Important for autoinhibitory function 59..64 1/4 (25%)
Interaction with VPS4A 151..222 34/76 (45%)
Intramolecular interaction with N-terminus 151..220 33/74 (45%)