DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and chmp2a

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001005008.1 Gene:chmp2a / 448496 XenbaseID:XB-GENE-1005459 Length:220 Species:Xenopus tropicalis


Alignment Length:233 Identity:58/233 - (24%)
Similarity:116/233 - (49%) Gaps:31/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEI 67
            ||||  .|.|:|.:::....:.|...::||:.:.::::|:|:...:|:.|::...|...|:||::
 Frog     4 LFGR--RKTPEEMLRQNQRALNKAMREMDRERQKLEQQEKKIIADIKKMAKQGQMDAVKIMAKDL 66

  Fly    68 VNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSK 132
            |..|:.:.:....:|::.::.::::...|...:|.:::..|:.:..|...::.|::..||.:..|
 Frog    67 VRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFEK 131

  Fly   133 EMMKAGIIEEMLDETMDSLEESEELEEEASKEVDKVLWEI-------------TDGKLGEAPLPP 184
            :.....:.|||:::.:|.....|:.|||:...|.:||.|:             |.|.|..|    
 Frog   132 QSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLTLTDELSNLPSTGGSLSVA---- 192

  Fly   185 EATPADKASASAARVEAEQDDEEGEELQEMQSRLASLR 222
               .|.|...|||..:|:.|.||         ||.:||
 Frog   193 ---GAKKGEPSAALADADADLEE---------RLNNLR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 38/181 (21%)
chmp2aNP_001005008.1 Snf7 17..185 CDD:367460 34/167 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..208 10/35 (29%)
MIT-interacting motif 208..218 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.