DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and Vps2

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_651455.1 Gene:Vps2 / 43164 FlyBaseID:FBgn0039402 Length:256 Species:Drosophila melanogaster


Alignment Length:204 Identity:53/204 - (25%)
Similarity:104/204 - (50%) Gaps:11/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEI 67
            |||:..|  |.|.:::....:.|....|||:...::::|:|:...:|:.|::...|...|:||::
  Fly     4 LFGKKIS--PDEMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDL 66

  Fly    68 VNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSK 132
            |..|:...:....||::.::.::::...|...:|.:::..|:.:|.|...:..|::..|::|..|
  Fly    67 VRTRRYAKKFMLMKANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEK 131

  Fly   133 EMMKAGIIEEMLDETMDSLEESEELEEEASKEVDKVLWEI---TDGKLGEAPLPPEA------TP 188
            :.....:.|||:::.:|...|.|..|||....|.:||.|:   ...:||:.|....:      ..
  Fly   132 QSEMMDMKEEMINDAIDDAMEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPSASGSLSIAGGAG 196

  Fly   189 ADKASASAA 197
            |.||.|.||
  Fly   197 AQKAQAVAA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 41/177 (23%)
Vps2NP_651455.1 Snf7 17..185 CDD:281366 41/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438213
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10476
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.