DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and chmp2bb

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_998069.1 Gene:chmp2bb / 405840 ZFINID:ZDB-GENE-040426-2539 Length:214 Species:Danio rerio


Alignment Length:208 Identity:56/208 - (26%)
Similarity:113/208 - (54%) Gaps:7/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNARKAI 74
            |...:.::|...::|....|:.|...:::::|::::..:|:.|:..:||.|.:|||::|..||..
Zfish     8 KTVDDVIKEQNKELRGTQRQIARDRTALEKQEKQLEMEIKKMAKTGNRDACKVLAKQLVQVRKQK 72

  Fly    75 NRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGI 139
            .|.|...:.:.|:..|.|...|.:::||::..:|:.:||:...:...:....:::..||..|..:
Zfish    73 TRTYAVSSKVTSMSTQTKLMNSQMKMAGAMATTTKTMQAVNKKMDPKKTMQTLQNFQKETAKMDM 137

  Fly   140 IEEMLDETMDSLEESEELEEEASKEVDKVLWEI---TDGKLGEAPLPPEATPADKASASAARVEA 201
            .|||:::|:|.:.|....|||:...|::||.||   ..||:..||.....||    ||:.|:.:.
Zfish   138 TEEMMNDTLDEIFEDSGDEEESQDIVNQVLDEIGIEISGKMAHAPSAARKTP----SAATAKADG 198

  Fly   202 EQDDEEGEELQEM 214
            ..|::...:|:.:
Zfish   199 ISDEDIERQLKAL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 48/171 (28%)
chmp2bbNP_998069.1 Snf7 16..185 CDD:281366 48/168 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..199 7/24 (29%)
MIT-interacting motif 202..212 1/10 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.