DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and Chmp1

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster


Alignment Length:201 Identity:48/201 - (23%)
Similarity:93/201 - (46%) Gaps:26/201 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNAR-KAINRIYTSKAHLNSIQMQMK 92
            :|:|..:..::||:..|...|:|.||.:.|...|.|:..:..: :|:|.:..| |.::::..:::
  Fly    19 ELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYLRMS-ARVDAVASRVQ 82

  Fly    93 NQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLDETM-DSLEESEE 156
            :.|:|.:|.||:....:.:.|....:...:::.:|.....:.....:...:::.|| |::..|  
  Fly    83 SALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVMEGTMSDTVTTS-- 145

  Fly   157 LEEEASKEVDKVLWEITDGKLGEAPLP-----PEATPADKASASAARVEAEQDDEEGEELQEMQS 216
               ....:||.:|.::.|    ||.|.     |....:....||.| |..|||        |:..
  Fly   146 ---VPQGDVDNLLQQVAD----EAGLELNMELPSGVQSQSVGASTA-VSQEQD--------ELTQ 194

  Fly   217 RLASLR 222
            |||.||
  Fly   195 RLARLR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 35/164 (21%)
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438216
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10476
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.