DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and Chmp2a

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_006228179.1 Gene:Chmp2a / 365191 RGDID:1305050 Length:247 Species:Rattus norvegicus


Alignment Length:259 Identity:59/259 - (22%)
Similarity:116/259 - (44%) Gaps:56/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEI 67
            ||||  .|.|:|.:::....:.:...:|||:.:.::.:|:|:...:|:.|::...|...|:||::
  Rat     4 LFGR--RKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDL 66

  Fly    68 VNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLV-------------- 118
            |..|:.:.:....:|::.::.::::...|...:|.:::..|:.:..|...|              
  Rat    67 VRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQVCPSQSTFPSPLTFR 131

  Fly   119 -----------RYPELAGIMRDMSKEMMKAGIIEEMLDETMDSLEESEELEEEASKEVDKVLWEI 172
                       :.|::..||.:..::.....:.|||:::.:|.....||.|||:...|.:||.|:
  Rat   132 QVTHPPCFFQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDEL 196

  Fly   173 -------------TDGKLGEAPLPPEATPADKASASA-ARVEAEQDDEEGEELQEMQSRLASLR 222
                         |.|.|.      .|....||.|:| |..:|:.|.||         ||.:||
  Rat   197 GLSLTDELSNLPSTGGSLS------VAAGGKKAEATASALADADADLEE---------RLKNLR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 38/206 (18%)
Chmp2aXP_006228179.1 Snf7 17..210 CDD:397437 35/192 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.