DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and Chmp1a

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001076782.1 Gene:Chmp1a / 365024 RGDID:1311083 Length:196 Species:Rattus norvegicus


Alignment Length:211 Identity:35/211 - (16%)
Similarity:97/211 - (45%) Gaps:30/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KIRKEGNQLDRQIRSIQR----EEEKVKRSLKQAAQKNDRDTCVILAKEIVNARKAINRIYTSKA 82
            :::....||::..:..::    |:.|||::|:   |||.....|.....|....:.:|.:..: :
  Rat     7 QLKFTAKQLEKLAKKAEKDSKAEQAKVKKALQ---QKNVECARVYAENAIRKKNEGVNWLRMA-S 67

  Fly    83 HLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLDET 147
            .::::..:::..::...|..::.:.|:.|....|.:...:::.:|....:::....:...:::::
  Rat    68 RVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSAMDLQKVSAVMDRFEQQVQNLDVHTSVMEDS 132

  Fly   148 MDSLEESEELEEEASKEVDKVLWEITDGKLGE-----APLPPEATPADKASASAARVEAEQDDEE 207
            :.|.......:|    :||.::.:|.:....|     :.||..|:...::|     |.:::|   
  Rat   133 VSSATTLTTPQE----QVDSLIVQIAEENGLEVLDQLSQLPEGASAVGESS-----VRSQED--- 185

  Fly   208 GEELQEMQSRLASLRS 223
                 ::..|||:||:
  Rat   186 -----QLSRRLAALRN 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 26/173 (15%)
Chmp1aNP_001076782.1 Snf7 12..195 CDD:419749 33/203 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.