DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and Chmp3

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_758834.1 Gene:Chmp3 / 282834 RGDID:708556 Length:223 Species:Rattus norvegicus


Alignment Length:228 Identity:135/228 - (59%)
Similarity:179/228 - (78%) Gaps:10/228 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAK 65
            |||||:|..|.|||.|.||:.|||||...:|||||.|||||||||||:|.||:|..::.||:|||
  Rat     1 MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAK 65

  Fly    66 EIVNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDM 130
            |::.:|||::::|.||||:||:.|.|||||:.|||||||||||||::||||||:.||:...||::
  Rat    66 EMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMREL 130

  Fly   131 SKEMMKAGIIEEMLDETMDSLEESEELEEEASKEVDKVLWEITDGKLGEAPLP-----PEATPAD 190
            ||||||||||||||::|.:|:::.||:||.|..|:|::|:|||.|.||:||..     ||..||.
  Rat   131 SKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKAPSKVTDALPEPEPAG 195

  Fly   191 KASASAARVEAEQDDEEGEELQEMQSRLASLRS 223
            ..:||    |.:::|:| |:|:.||||||:|||
  Rat   196 AMAAS----EGDEEDDE-EDLEAMQSRLATLRS 223

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 106/173 (61%)
Chmp3NP_758834.1 Intramolecular interaction with C-terminus. /evidence=ECO:0000250 2..113 72/110 (65%)
Snf7 18..187 CDD:281366 104/168 (62%)
Important for autoinhibitory function. /evidence=ECO:0000250 59..64 2/4 (50%)
Interaction with VPS4A. /evidence=ECO:0000250 151..223 34/76 (45%)
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 151..221 33/74 (45%)