DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and C01A2.4

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001369988.1 Gene:C01A2.4 / 182050 WormBaseID:WBGene00007216 Length:207 Species:Caenorhabditis elegans


Alignment Length:226 Identity:59/226 - (26%)
Similarity:112/226 - (49%) Gaps:22/226 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAK 65
            |.:|.:   .||||..:....::||....|:...|.:.|.|:::::.:|:.|.|...|....|||
 Worm     1 MNIFSK---PDPKELERANKRELRKTNRDLESDRRQMDRREKELEQEIKKLAAKGHNDAARHLAK 62

  Fly    66 EIVNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDM 130
            ::|..|....:.....|.::.:|.|..:..|..::..::..:.:.::||.:.:...::|..||:.
 Worm    63 QLVQLRNQKTKSIGMSARISGVQAQNSHMQSMAKMGSAMGTTVKTMKAMNAQMPLEKVAANMREF 127

  Fly   131 SKEMMKAGIIEEMLDETMDSLEESEELEEEASKEVDKVLWEI---TDGKLGEAPLPPEATPADKA 192
            .....|.|:.|||:::|:||:.::....:|....|::||.||   .:.||...|..|     .|.
 Worm   128 QMAQEKMGLTEEMMNDTLDSILDAPGDADEQDAIVNQVLDEIGIEMNSKLANVPALP-----TKV 187

  Fly   193 SASAARVEAEQDDEEGEELQEMQSRLASLRS 223
            |::|   .|:.||        ::::||.|||
 Worm   188 SSTA---PADFDD--------LEAQLARLRS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 42/171 (25%)
C01A2.4NP_001369988.1 Snf7 16..185 CDD:397437 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.