DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and vps-2

DIOPT Version :10

Sequence 1:NP_649451.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_496717.1 Gene:vps-2 / 174908 WormBaseID:WBGene00012903 Length:237 Species:Caenorhabditis elegans


Alignment Length:50 Identity:18/50 - (36%)
Similarity:22/50 - (44%) Gaps:11/50 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FVLLATFVNAAFSYKILVFSPA---TSKSHLI-------SNGRLADELAR 44
            ||.||:.:...|.|..||. ||   ...|.||       |.|.:.||.:|
 Worm   104 FVQLASIITGKFWYTYLVI-PAFGVYKASGLIRGFMSQGSEGGVEDEKSR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_649451.1 Snf7 18..187 CDD:460896 12/36 (33%)
vps-2NP_496717.1 Snf7 17..186 CDD:460896 17/49 (35%)

Return to query results.
Submit another query.