DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps24 and did-2

DIOPT Version :9

Sequence 1:NP_001303457.1 Gene:Vps24 / 40542 FlyBaseID:FBgn0037231 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_490974.1 Gene:did-2 / 171801 WormBaseID:WBGene00017735 Length:205 Species:Caenorhabditis elegans


Alignment Length:205 Identity:44/205 - (21%)
Similarity:95/205 - (46%) Gaps:33/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNAR-KAINRIYTSKAHLNSIQMQMK 92
            ||::..:..:::|:..|..|..|.:|.:::...:.|:..:..: :|:|.|..: |.::::..:::
 Worm    23 QLEKNAQRCEKDEKVEKDKLTAAIKKGNKEVAQVHAENAIRKKNEAVNYIKMA-ARIDAVAARVQ 86

  Fly    93 NQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDM---SKEMMKAGIIEEMLDETMDSLEES 154
            ...:..||..|:   :.|::||:|.::...|..:.:.|   .::.....:..:.:::|||    .
 Worm    87 TAATQKRVTASM---SGVVKAMESAMKSMNLEKVQQLMDRFERDFEDLDVTTKTMEKTMD----G 144

  Fly   155 EELEEEASKEVDKVLWEITDGKLG---EAPLP---PEATPADKASASAARVEAEQDDEEGEELQE 213
            ..:......:||.::.|..| |.|   ...||   |.|.|....:.|           |.::|.|
 Worm   145 TTVLNAPKSQVDALIAEAAD-KAGIELNQELPSNVPTALPTGTQAVS-----------EDKDLTE 197

  Fly   214 MQSRLASLRS 223
               |||:||:
 Worm   198 ---RLAALRN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps24NP_001303457.1 Snf7 18..187 CDD:281366 33/167 (20%)
did-2NP_490974.1 Snf7 16..181 CDD:304451 33/166 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.