DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and PRSS27

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:288 Identity:99/288 - (34%)
Similarity:142/288 - (49%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 GTKLLPMAPNCGE-NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAH 183
            |::....|..||. ...:|:|||.:|.:.|:||...|:  :.|:   |.||||||..::||||||
Human    16 GSQRAKAATACGRPRMLNRMVGGQDTQEGEWPWQVSIQ--RNGS---HFCGGSLIAEQWVLTAAH 75

  Fly   184 CVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYP-VEERIPHPQYPGNSRDQLN 247
            |... .|:..|..|.||.... ..|.             |:..|. |.:...:|.|.|.:...  
Human    76 CFRN-TSETSLYQVLLGARQL-VQPG-------------PHAMYARVRQVESNPLYQGTASSA-- 123

  Fly   248 DIALLRLRDEVQYSDFILPVCLPTLASQHNNIF-LGRKVVVAGWGR-TETNFTSNIKL--KAELD 308
            |:||:.|...|.::::|||||||    ..:.|| .|....|.|||. :|.:.....::  |..:.
Human   124 DVALVELEAPVPFTNYILPVCLP----DPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVP 184

  Fly   309 TVPTSECNQRYAT------QRRTVTTKQMCAGGVEG-VDSCRGDSGGPLLLEDYSNGNSNYYIAG 366
            .:.|.:||..|:.      |.:|:....:|||..|| .|:|:|||||||:.   ..|.| :..||
Human   185 IIDTPKCNLLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVC---LVGQS-WLQAG 245

  Fly   367 VVSYGPTPCGLKGWPGVYTRVEAYLNWI 394
            |:|:| ..|..:..||||.||.|:.|||
Human   246 VISWG-EGCARQNRPGVYIRVTAHHNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 93/268 (35%)
Tryp_SPc 138..397 CDD:238113 94/269 (35%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 93/268 (35%)
Tryp_SPc 36..275 CDD:238113 94/268 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.