DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Prss32

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:326 Identity:95/326 - (29%)
Similarity:138/326 - (42%) Gaps:79/326 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GNHPQPTQTTKPTKRSGTKLLPMAPNCGE-NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHH 167
            |:...||.:..|:..:|.:.:.:...||. ....|:|.|.:.....:||...:...     ..|.
Mouse    19 GSEVLPTDSDSPSTTTGRRSIDLDSVCGRPRTSGRIVSGQDAQLGRWPWQVSVREN-----GAHV 78

  Fly   168 CGGSLINHRYVLTAAHC----------------VSAIPSDWELTGVRLGEWDASTNPDCTVGKNG 216
            ||||||...:|||||||                :|:.|.|                         
Mouse    79 CGGSLIAEDWVLTAAHCFNQGQSLSIYTVLLGTISSYPED------------------------- 118

  Fly   217 RRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFL 281
                |||.....|.:.|.||.|..:.... .||||::|...:.::|::||||||   ...:.:..
Mouse   119 ----NEPKELRAVAQFIKHPSYSADEHSS-GDIALVQLASPISFNDYMLPVCLP---KPGDPLDP 175

  Fly   282 GRKVVVAGWGRTETN------FTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQ-------MCA 333
            |....|.|||...||      ||..   :.::..:....||..|  |..::...:       :||
Mouse   176 GTMCWVTGWGHIGTNQPLPPPFTLQ---ELQVPLIDAETCNTYY--QENSIPGTEPVILEGMLCA 235

  Fly   334 GGVEG-VDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENN 397
            |..|| .|:|.|||||||:.:.    |..:..|||||:| :.|.|...|||||.|..|::||:|.
Mouse   236 GFQEGKKDACNGDSGGPLVCDI----NDVWIQAGVVSWG-SDCALFKRPGVYTNVSVYISWIQNT 295

  Fly   398 V 398
            :
Mouse   296 M 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 85/286 (30%)
Tryp_SPc 138..397 CDD:238113 86/288 (30%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 85/286 (30%)
Tryp_SPc 54..295 CDD:238113 86/288 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.