DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Prss41

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:311 Identity:103/311 - (33%)
Similarity:144/311 - (46%) Gaps:84/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KRSGTKLLPMAPNCG--ENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVL 179
            |.:..|||.|.  ||  .:...|:|||.|:.:..:||.|.:...     |.|.|||||::||:||
  Rat    34 KNTDIKLLSMP--CGRRNDIRSRIVGGIESVRGRWPWQASLRLR-----KFHRCGGSLLSHRWVL 91

  Fly   180 TAAHCVSAI--PSDWELTGVRLGE-------WDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPH 235
            |||||....  |..|.   |:||:       |    |.:...|:            |.|::.|. 
  Rat    92 TAAHCFRKFLDPKKWT---VQLGQLTSKPSFW----NREAFSGR------------YRVKDIII- 136

  Fly   236 PQYPGNSRDQL--NDIALLRLRDEVQYSDFILPVC-LPTLA-SQHNNIFLGRKVVVAGWGRTETN 296
                 ||.|:|  :|:|||||...|.|:.||.||| ||:.: |||.     .:..|.|||     
  Rat   137 -----NSEDKLKYHDLALLRLASSVTYNKFIQPVCVLPSASMSQHQ-----PRCWVTGWG----- 186

  Fly   297 FTSNIKLKAELDTVP--------------TSECNQ--RYATQRRTVTTKQMCAGGVEG-VDSCRG 344
                 .|:.:|..:|              .|.|.:  .:|::...:|....|||..:| .|:|.|
  Rat   187 -----ALQEDLKPLPPPYHLREVQVTVLNLSRCQELFSFASRYHLITRDVFCAGAEDGSADTCSG 246

  Fly   345 DSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIE 395
            ||||||:    .|.:..:|..|:||.| ..||....||:||.|..:.:||:
  Rat   247 DSGGPLV----CNMDGLWYQIGIVSRG-VGCGRPKLPGIYTNVSHHYDWIK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 94/286 (33%)
Tryp_SPc 138..397 CDD:238113 95/288 (33%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 94/286 (33%)
Tryp_SPc 55..292 CDD:238113 94/286 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.