DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG34171

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:253 Identity:60/253 - (23%)
Similarity:98/253 - (38%) Gaps:61/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPY 224
            ||:  .|.|.|.::.:|:|||:|||::      :..||.:...........::.|.  .:..|..
  Fly    51 PGD--NHFCTGVILTNRHVLTSAHCIT------DKNGVMMSPKRIVVALCASLFKT--PESEEFV 105

  Fly   225 VDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQY-SDFILPVCLPTLASQHNN-------IFL 281
            ||  :...|.||.|   .|:|.||||:::|:..|:. ...:.||.|...:.:..|       ||.
  Fly   106 VD--IHNMIIHPYY---HRNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFG 165

  Fly   282 GRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVD------ 340
            .|:   ..:|...:....|::|:      |..||.:         ..|.:.|...|..|      
  Fly   166 VRR---QRFGSFHSMLLVNVELR------PFDECLK---------VKKSLMAARPENEDLICVKS 212

  Fly   341 ----SCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWI 394
                .|..|.||||..:....|         ::.|...|.... |..::.|..|.:|:
  Fly   213 TEKQMCTTDFGGPLFCDGQLYG---------IALGSINCSSPD-PVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 59/251 (24%)
Tryp_SPc 138..397 CDD:238113 60/253 (24%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 59/251 (24%)
Tryp_SPc 38..263 CDD:304450 60/253 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.