DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Prss33

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:287 Identity:91/287 - (31%)
Similarity:128/287 - (44%) Gaps:60/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CGE-NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHH-CGGSLINHRYVLTAAHCVS--AIPS 190
            ||: ....|:|||.:....|:||...|::      :|.| ||||||..::||||.||.|  .:||
  Rat    25 CGQPRMSSRIVGGRDAQDGEWPWQTSIQH------RGAHVCGGSLIAPQWVLTAGHCFSRRVLPS 83

  Fly   191 DWELTGVRLG--EWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQL-NDIALL 252
            ::   .|.||  ..|.:::.:..|               ||...:..|.|   |.|:. .|:|||
  Rat    84 EY---SVLLGALSLDVTSSHELLV---------------PVLRVLLPPDY---SEDEARGDLALL 127

  Fly   253 RLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLK-------AELDTV 310
            :|...|..|..|.|||||...|....   |....|.|||    :.:..:.|.       ..:..:
  Rat   128 QLSHPVSLSARIQPVCLPAPGSHPPP---GSPCWVTGWG----SLSPGVPLPKGRPLQGVRVPLL 185

  Fly   311 PTSECNQRY------ATQRRTVTTKQMCAGGVEG-VDSCRGDSGGPLLLEDYSNGNSNYYIAGVV 368
            .:..|::.|      ....|.|....:|||...| .|:|:|||||||...:    :..:.:.|||
  Rat   186 DSRACDRLYHMGANVPKSERIVLPGNLCAGYRRGHKDACQGDSGGPLTCME----SGRWVLVGVV 246

  Fly   369 SYGPTPCGLKGWPGVYTRVEAYLNWIE 395
            |:| ..|.|...|||||.|..|..||:
  Rat   247 SWG-KGCALPNRPGVYTNVAKYSPWIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 87/276 (32%)
Tryp_SPc 138..397 CDD:238113 88/278 (32%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 87/276 (32%)
Tryp_SPc 34..272 CDD:238113 87/276 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.