DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG11313

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:401 Identity:145/401 - (36%)
Similarity:201/401 - (50%) Gaps:49/401 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLWMLLMGTSSTYAQEIFGYCRTPDENSGTCINLRECGYLFELLQSEEVTEQDRRFLQASQCGYR 73
            :|.:|::.|:  :.|.:  .||.|::.:|.|:|:..|..|..:|.....|:.:.||::.|:|...
  Fly     8 LLCLLIIRTA--HGQYV--SCRNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESRCLVS 68

  Fly    74 NGQVLEKHFCFTNVQICCANSRMRNQQPQWGNHPQPTQTTKPTKR-SGTKLLPMAPNCGENFG-D 136
            :...|.        .:||......|           |...:|... ..:.|||....||.:.. :
  Fly    69 DQSDLP--------FVCCTPDTDYN-----------TTRARPNDEVIHSTLLPDRSICGGDIAYN 114

  Fly   137 RVVGGNETTKREFPWMALIEYTKP--GNVKGHHCGGSLINHRYVLTAAHCVSAI----PSDWEL- 194
            ::..||||...||.||.|:|| :|  |.....:|.|||||:|||:||||||||.    ..|... 
  Fly   115 QITKGNETVLTEFAWMVLLEY-RPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFR 178

  Fly   195 TGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQ 259
            ..|||||.:.|...||.   |||  |....|...|||...|..:  .:|...|||||:||..||.
  Fly   179 VSVRLGEHNTSAVVDCL---NGR--CLPEPVQIAVEEIRIHESF--GTRLFWNDIALIRLAREVA 236

  Fly   260 YSDFILPVCLP-TLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQR 323
            ||..|.||||| |:..|  |...|:...|||||||.|:.:|.:|:|..:..|....|.::||: .
  Fly   237 YSPSIRPVCLPSTVGLQ--NWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYAS-I 298

  Fly   324 RTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVE 388
            ..:....:||.|....|||.|||||||:.  :..|  .:.:.|:||:| ..||.:.||.|||.|.
  Fly   299 VVLGDSHLCAEGRSRGDSCDGDSGGPLMA--FHEG--VWVLGGIVSFG-LNCGSRFWPAVYTNVL 358

  Fly   389 AYLNWIENNVR 399
            :|..||..|:|
  Fly   359 SYETWITQNIR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855 15/61 (25%)
Tryp_SPc 137..394 CDD:214473 112/264 (42%)
Tryp_SPc 138..397 CDD:238113 114/266 (43%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 15/61 (25%)
Tryp_SPc 116..367 CDD:238113 114/266 (43%)
Tryp_SPc 116..364 CDD:214473 112/263 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.