DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:296 Identity:82/296 - (27%)
Similarity:132/296 - (44%) Gaps:58/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PQPTQTTKPTKRSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGS 171
            |.|.|...||        |:     ::...|:..|....:.:.|::..:.::..||   ..||||
  Fly    18 PAPAQKLTPT--------PI-----KDIQGRITNGYPAYEGKVPYIVGLLFSGNGN---WWCGGS 66

  Fly   172 LINHRYVLTAAHCVSAIPSDWELTGVRLGEWDAS--TNPDCT--VGKNGRRDCNEPYVDYPVEER 232
            :|.:.:|||||||.:.      .:||.: .:.||  |.|..|  ||..               :.
  Fly    67 IIGNTWVLTAAHCTNG------ASGVTI-NYGASIRTQPQYTHWVGSG---------------DI 109

  Fly   233 IPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNF 297
            |.|..|  ||.:..|||:|:| ...|.:...:..|.||:...::.: :.|...|.:|||.|....
  Fly   110 IQHHHY--NSGNLHNDISLIR-TPHVDFWSLVNKVELPSYNDRYQD-YAGWWAVASGWGGTYDGS 170

  Fly   298 TSNIKLKA-ELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSN 361
            .....|:: ::..:..|:|::.:     ::....:|.....|..:|.|||||||:..|   ||. 
  Fly   171 PLPDWLQSVDVQIISQSDCSRTW-----SLHDNMICINTDGGKSTCGGDSGGPLVTHD---GNR- 226

  Fly   362 YYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENN 397
              :.||.|:|.......|.|.|::||..||:||.:|
  Fly   227 --LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 73/261 (28%)
Tryp_SPc 138..397 CDD:238113 74/263 (28%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 74/263 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.