DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG4815

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:289 Identity:67/289 - (23%)
Similarity:106/289 - (36%) Gaps:83/289 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 FGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAI-PSDWELTGV 197
            |..|:..|.:||......:.:..:    |.:...|..:|:..|::||||||...: .|.:.:.|.
  Fly    31 FHPRIYNGIKTTVESLGGVGIQLF----NGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGG 91

  Fly   198 RLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLR----LRDE- 257
            :..|:....|   ...||..           :..:| ||:|.  ....:.|:|:.:    ||.: 
  Fly    92 KSAEFTWHGN---NFNKNKL-----------IRVQI-HPKYA--KMKFIADVAVAKTKYPLRSKY 139

  Fly   258 VQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWG---------RTETNFTSNIKLKAELDTVPTS 313
            :.|:.....|..|.           .|::.||||         |.:| |.|     .::..|...
  Fly   140 IGYAQLCRSVLHPR-----------DKLIAAGWGFEGGVWDESRKKT-FRS-----MKVGIVSKR 187

  Fly   314 ECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLK 378
            :|.::.   .|.:....:|||.......|.|||||||||                  |...||:.
  Fly   188 DCEKQL---DRKMPPNIICAGAYNNKTLCFGDSGGPLLL------------------GRQVCGIN 231

  Fly   379 GW---------PGVYTRVEAYLNWIENNV 398
            .|         |.||..|..|..:|:..:
  Fly   232 TWTFKCGNNEKPDVYMGVRYYAKFIKRTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 65/280 (23%)
Tryp_SPc 138..397 CDD:238113 65/282 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 62/268 (23%)
Trypsin 49..256 CDD:278516 61/265 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.