DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG5909

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:404 Identity:123/404 - (30%)
Similarity:183/404 - (45%) Gaps:49/404 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLWMLLMGTSSTYAQEIFGYCRTPDENSGTCINLRECGYLFELL--QSEEVTEQDRRFLQASQCG 71
            :|..|::..||         |.||.:.:|.||..:||.::.::|  ....:..:....:...||.
  Fly    14 ILPQLVISQSS---------CVTPAQAAGQCIRYQECPFVQKILGIYGRNIPRKIHNQISEMQCR 69

  Fly    72 YRNGQVLEKHFCFTNVQ---ICCANSRMRNQQPQWGNHPQPTQTTKPT-------KRSGTKLLPM 126
                       ..||.:   :||.     |:.|...|.....:..:..       .|.|.:||..
  Fly    70 -----------STTNTRDFHLCCP-----NEAPPQSNQESQRKVVRSEGGNLNRYDRQGLQLLNS 118

  Fly   127 APNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSD 191
            ..|||.....:|.||......:|||:||::| |..:.:...||||||:.|::||||||:...|  
  Fly   119 VTNCGNKGNPKVSGGKTARPGDFPWVALLKY-KINDPRPFRCGGSLISERHILTAAHCIIDQP-- 180

  Fly   192 WELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRD 256
             |:..|||||.|..:..||.......|.|..||.:|.:|:...||.|......  :|:|:::|..
  Fly   181 -EVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKIS--HDVAIIKLDR 242

  Fly   257 EVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPT-SECNQRYA 320
            .|:....|.||||| :..:...:...:...|||||.||.. |...||:..|.|..: :||.|.| 
  Fly   243 VVKEKSHIKPVCLP-IDQKSQELDFDQSFFVAGWGGTEKE-TVATKLQQALITRKSLNECRQYY- 304

  Fly   321 TQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYT 385
             .:..|:...:||.|.....:|:||||||:..:............||||:|...|| :..|||:.
  Fly   305 -NKGEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCG-QNQPGVFA 367

  Fly   386 RVEAYLNWIENNVR 399
            .|...|.||..|::
  Fly   368 SVIDMLPWITQNLQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855 13/66 (20%)
Tryp_SPc 137..394 CDD:214473 91/257 (35%)
Tryp_SPc 138..397 CDD:238113 93/259 (36%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829 14/67 (21%)
Tryp_SPc 129..376 CDD:214473 91/257 (35%)
Tryp_SPc 132..379 CDD:238113 92/257 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.