DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and grass

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:408 Identity:133/408 - (32%)
Similarity:194/408 - (47%) Gaps:78/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MGTSST---YAQEIFGYCRTPDENSGTCINLRECGYLFELL-----QSEEVTEQDRRFLQASQCG 71
            ||..|.   ||.:    |.|||.:.|.|:....|..:.|.|     ..::|......:||.:.||
  Fly    19 MGVQSARADYADD----CTTPDGDQGQCMPFSSCRTIEERLTEAQKAGQKVPADYASYLQKALCG 79

  Fly    72 YRNGQVLEKHFCFTNVQICCANSRMRNQQPQWGNHPQPTQTTKPTKRSGTKLLPMAP----NCGE 132
            ..||   .:||       ||.::.:::                     .:|::.:..    :||.
  Fly    80 EFNG---VRHF-------CCPSANIQH---------------------NSKVMSLFKDENFDCGN 113

  Fly   133 NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGV 197
            ....||..|.|......|||||:.|.:.|..: ..|||::|:.||:|||||||..:.:|  |..:
  Fly   114 FLSQRVSNGYEVKLSSRPWMALLRYQQFGESR-FLCGGAMISERYILTAAHCVHGLQND--LYEI 175

  Fly   198 RLGEWDASTNPDCTVGKNGR-RDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYS 261
            ||||...||..||.  :.|| :.|..|.|:..:|:.:.|.:|  ::|..::|||||:|...|.:.
  Fly   176 RLGEHRISTEEDCR--QQGRKKKCAPPVVNVGIEKHLIHEKY--DARHIMHDIALLKLNRSVPFQ 236

  Fly   262 DFILPVCLPTL------ASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYA 320
            ..|.|:|||..      |.|.:..|      |.|||.||...:|::.|:|.:...|.|.|:|.| 
  Fly   237 KHIKPICLPITDELKEKAEQISTYF------VTGWGTTENGSSSDVLLQANVPLQPRSACSQAY- 294

  Fly   321 TQRRTVTTKQMCAGGVEGVDSCRGDSGGPL-----LLEDYSNGNSNYYIAGVVSYGPTPCGLKGW 380
              ||.|...|:|.||.:..|||:|||||||     .|.:|:.....:   |:||.|...||....
  Fly   295 --RRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEF---GIVSQGVVTCGQISL 354

  Fly   381 PGVYTRVEAYLNWIENNV 398
            ||:||.|..|:.||.:.:
  Fly   355 PGLYTNVGEYVQWITDTM 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855 18/66 (27%)
Tryp_SPc 137..394 CDD:214473 103/268 (38%)
Tryp_SPc 138..397 CDD:238113 104/270 (39%)
grassNP_651543.1 CLIP 32..90 CDD:197829 19/67 (28%)
Tryp_SPc 121..371 CDD:238113 103/268 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.