DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG31219

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:321 Identity:115/321 - (35%)
Similarity:169/321 - (52%) Gaps:49/321 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QICCANSRMRNQQPQWGNHPQPTQTTKPTKRSGTKLLPMAPNCGENFGD-RVVGGNETTKREFPW 151
            :|||         |..||.                 ||....||::... |:|||:|.....:||
  Fly    64 RICC---------PPPGNR-----------------LPSTEICGQSLSTYRMVGGSEARPNGYPW 102

  Fly   152 MALIEYTKPGNVK-GHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGE----WDASTNPDCT 211
            ||::.|.....:: ...|.|||||:|||||:||||:.||.|..|..|||||    :|.:.|||| 
  Fly   103 MAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDC- 166

  Fly   212 VGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLN-DIALLRLRDEVQYSDFILPVCLPTLASQ 275
              ::....|..|.::..:|:.|.|..:...|...:. |||||||:..|:|...|:|:|:|     
  Fly   167 --RDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIP----- 224

  Fly   276 HNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQR--YATQRRTVTTKQMCAGGVEG 338
            .:..|...|:.:||||:|.....|.:.:...:.....:.|..|  |....:::   |:||||.:|
  Fly   225 KHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSL---QICAGGYDG 286

  Fly   339 VDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNVR 399
            ||:|:|||||||::   :..||:.|:||:.:||...||..|.||:|||..|:|.||:..:|
  Fly   287 VDTCQGDSGGPLMV---TMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855 1/2 (50%)
Tryp_SPc 137..394 CDD:214473 102/264 (39%)
Tryp_SPc 138..397 CDD:238113 103/266 (39%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 102/264 (39%)
Tryp_SPc 90..342 CDD:238113 103/265 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463209
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.