DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG5255

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:265 Identity:71/265 - (26%)
Similarity:119/265 - (44%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLG 200
            :|:|||.|......|:...::....|   .|.|||::|:.|:::|||||...    .:.|..|: 
  Fly    28 NRIVGGEEAAAGLAPYQISLQGIGSG---AHSCGGAIIDERWIITAAHCTRG----RQATAFRV- 84

  Fly   201 EWDASTNPDCTVGKNGRRDCNEPYVDYPVEERI-PHPQYPGNSRDQLNDIALLRLRDEVQYSDFI 264
                         ..|.:|.::....|...:|| .|..|.  .|...||||||.|.:.:.:.:..
  Fly    85 -------------LTGTQDLHQNGSKYYYPDRIVEHSNYA--PRKYRNDIALLHLNESIVFDNAT 134

  Fly   265 LPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKA-ELDTVPTSECNQRYATQRRTVTT 328
            .||.|     .|..:..|.::::.|||..........:|:: |::.||..:|...:....| |..
  Fly   135 QPVEL-----DHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTR-VDI 193

  Fly   329 KQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNW 393
            ..:|....:|..:|.|||||||:    .||.    :..:|::| .||. ||:|..:..:..|.::
  Fly   194 GHVCTFNDKGRGACHGDSGGPLV----HNGK----LVALVNWG-LPCA-KGYPDAHASISYYHDF 248

  Fly   394 IENNV 398
            |..::
  Fly   249 IRTHL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 70/258 (27%)
Tryp_SPc 138..397 CDD:238113 70/260 (27%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 70/258 (27%)
Tryp_SPc 30..252 CDD:238113 70/260 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.